PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29687.m000562
Common NameRCOM_0622760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 503aa    MW: 55151.5 Da    PI: 5.8526
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29687.m000562genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY24.17e-08219235319
                    -SS-EEEEEEE--TT-S CS
           WRKY   3 DgynWrKYGqKevkgse 19 
                    DgynWrKYGqK+vk+ +
  29687.m000562 219 DGYNWRKYGQKQVKSPK 235
                    9*************865 PP

2WRKY98.15.7e-31363420259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  29687.m000562 363 SDGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVDNTDAVIITYKGVHDHD 420
                    7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.5E-5216233IPR003657WRKY domain
SMARTSM007740.0069217247IPR003657WRKY domain
SuperFamilySSF1182901.57E-5217247IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.3E-32347422IPR003657WRKY domain
PROSITE profilePS5081132.099357422IPR003657WRKY domain
SuperFamilySSF1182903.92E-27358422IPR003657WRKY domain
SMARTSM007744.1E-35362421IPR003657WRKY domain
PfamPF031062.1E-23364419IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MAESKSVEAL QVQHKRQVDE HNDHVLEEQE EDDDDEEEDS QLSELDQLGE SQQPEELSSG  60
PVELEALVAV PTSTAILENK QCVGRKKREV IVCLVRVEVS DLAGLEDNAG LEKHVDDSEF  120
KEQDGISHPE VSGDVTSQCA EAQTQNQLQS SVCPTSLSEL SPTSVTQPIS SAPSPTLPEP  180
RVSPSKFNNY NACIPEADQQ NSSELKSLSL PIVKAHVLDG YNWRKYGQKQ VKSPKEIVNK  240
GTHSHDPPRK NNSTRGSKVA LLSAPVLENS MKEHSMGMHT DSSQSTLFKD SIQETPNISE  300
KKRQNSSGSD GNGKILIKEE HVSEPEPKRR MKKENLECSG TLLKPGKKPK FVVHAAGDVG  360
ISSDGYRWRK YGQKMVKGNP HPRNYYRCTS AGCPVRKHIE TAVDNTDAVI ITYKGVHDHD  420
MPVPKKRHGP PSAPLVAAAA PASMSNLQLK KTDTLPNQIS STQWSVGKEG ELTSETLDLG  480
GEKEKAIESA RTLLSIGFEI KPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-26350422274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015581004.10.0PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 32
SwissprotP595831e-110WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLB9STQ70.0B9STQ7_RICCO; WRKY transcription factor, putative
STRINGVIT_11s0037g00150.t011e-162(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51983456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-102WRKY DNA-binding protein 32